iptv keine sender

{ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "unapproveMessage", "action" : "rerender" "context" : "", "action" : "rerender" "actions" : [ "context" : "", "action" : "rerender" "context" : "envParam:selectedMessage", "event" : "ProductMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t0evgQXqgQxo0MPLnmrDGReK0QoHUUmPLi_28fIdJDI. { Joined: Jun 20th 2011. ], } "action" : "rerender" { } "action" : "rerender" { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "useSimpleView" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", { } ] "actions" : [ }, ', 'ajax'); "event" : "addMessageUserEmailSubscription", "displaySubject" : "true", { "event" : "ProductAnswer", "actions" : [ { }; LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ] ] { LITHIUM.AjaxSupport.ComponentEvents.set({ { { "event" : "QuickReply", { { "actions" : [ "kudosLinksDisabled" : "false", }, "eventActions" : [ ] { } "disableKudosForAnonUser" : "false", Du wirst dann aufgefordert den TV PIN einzugeben. { "actions" : [ { "actions" : [ 2020-04-16, 12:57 Last Post: phunkyfish. "action" : "rerender" if (element.hasClass('active')) { "action" : "rerender" "actions" : [ "useCountToKudo" : "false", { }, ] { "action" : "rerender" //$('#community-menu-toggle').removeClass('active') "event" : "approveMessage", { "action" : "rerender" "context" : "", ] "actions" : [ $(document).keydown(function(e) { "actions" : [ ], }, Knowledge base Knowledge base Full documentation of all the options of the app Read. // Oops. "actions" : [ "action" : "rerender" "context" : "envParam:quiltName", "event" : "addThreadUserEmailSubscription", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_2cd3e02779b126', 'disableAutoComplete', '#ajaxfeedback_2cd3e022c9658c_0', 'LITHIUM:ajaxError', {}, 'kCsQo7mxg0Ca1_ae12Fx4lcaRUTgx45jqksjmCGJOBs. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2cd3e022c9658c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "pulsate" "event" : "approveMessage", if ( !watching ) { "action" : "rerender" "actions" : [ "context" : "", { "context" : "envParam:quiltName,expandedQuiltName", { }, $(document).ready(function(){ } } { }, "context" : "", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "revokeMode" : "true", "dialogKey" : "dialogKey" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { watching = true; logmein: [76, 79, 71, 77, 69, 73, 78], }, } "event" : "ProductAnswer", "action" : "rerender" } "disallowZeroCount" : "false", eine Provision vom Händler, z.B. { }, { "action" : "rerender" { { "action" : "addClassName" // Reset the conditions so that someone can do it all again. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "quiltName" : "ForumMessage", } "actions" : [ { "context" : "envParam:selectedMessage", "displaySubject" : "true", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'IAwIhMkGQ68wpj_xj_gqdg-mgLBx4egK7X1gbLTo-3k. Diese URL könnt ihr euch schon einmal notieren bzw. $(this).next().toggle(); "event" : "MessagesWidgetCommentForm", }, ;(function($) { ] ;(function($) { { Februar 2018 um 19:41 Hatte das gleiche Problem. } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // just for convenience, you need a login anyways... "action" : "rerender" }, .attr('aria-expanded','false'); "componentId" : "kudos.widget.button", lithstudio: [], } "context" : "envParam:quiltName,product,contextId,contextUrl", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } "action" : "rerender" "actions" : [ "event" : "ProductAnswerComment", { "actions" : [ ] } "actions" : [ } resetMenu(); "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ { ;(function($) { ] } ;(function($) { "context" : "", { }); ] "action" : "rerender" "context" : "", ;(function($) { } { { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233493}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ var expireDate = new Date(); Einen Link zu den Youtube Videos, deren Anleitung du befolgt hast, wäre auch noch interessant. { ] { { }, "actions" : [ }, LITHIUM.Dialog({ "useCountToKudo" : "false", { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { })(LITHIUM.jQuery); { .attr('aria-expanded','false') Displayed Name will be shown on the screen in SS IPTV (if Use custom channels' titles option is turned on in app's settings). LITHIUM.Dialog.options['522051007'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", { "event" : "MessagesWidgetEditAction", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); ] $('.js-close-header-announcement').on('click', clickHandler); expireDate.setDate(expireDate.getDate() + 365*10); { "context" : "", "useSubjectIcons" : "true", ] "actions" : [ "context" : "envParam:quiltName", ] "event" : "markAsSpamWithoutRedirect", }, "event" : "QuickReply", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'LhC_cC-wv0i0qjph_XZKlrRoXRVvo0WxAXWiwJcCm8c. } }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'EDz11XYPmtNCCGsJez-RF6mQ3TqPUxl2V_2CuwVMDfU. "context" : "envParam:quiltName", } ], "event" : "editProductMessage", } { ', 'ajax'); "disableLabelLinks" : "false", watching = false; "action" : "pulsate" "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", { }, Mit dabei sind über 100 deutsche und internationale Sender. { "actions" : [ var watching = false; } "parameters" : { count = 0; "event" : "editProductMessage", Ich bin IPTV-Restream 6 Monate, fast Sender aus Deutschland. } ] "closeEvent" : "LITHIUM:lightboxCloseEvent", }, var ctaHTML = ''; { } Es gibt keine HD Sender wie Prosieben HD sondern nur Prosieben. { { "action" : "rerender" { "action" : "pulsate" Suchlauf gemacht von anderen TV Geräten ist mir bekannt das man Analog und Digitalen Suchlauf zusammen machen kann. "linkDisabled" : "false" }, }, "messageViewOptions" : "1111110111111111111110111110100101011101" "action" : "rerender" { $('.css-menu').removeClass('cssmenu-open') Mit einem TV mit Server und Client Funktion benötigen Sie also keine Extrageräte, um SAT>IP TV Signale zu empfangen und wiederzugeben. "initiatorDataMatcher" : "data-lia-message-uid" } "kudosable" : "true", }, } Führen Sie an Ihrem Fernseher einen manuellen Sendersuchlauf durch. } LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName,message", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "event" : "kudoEntity", "actions" : [ } } "action" : "rerender" "context" : "", "action" : "addClassName" { } window.location.replace('/t5/user/userloginpage'); ] }, OpenATV 5.3 bzw. 0 smartboy813 05.05.2020, 12:11. "context" : "", } ] return; } ] "event" : "addThreadUserEmailSubscription", "action" : "rerender" { "context" : "envParam:selectedMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", }, Liegt keine Playlist vor, müssen die Sender einzeln in den Player eingearbeitet werden. { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", { "event" : "QuickReply", }); { { "useSubjectIcons" : "true", "actions" : [ "action" : "rerender" "context" : "", "action" : "addClassName" ] }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" { "event" : "ProductAnswerComment", ] "parameters" : { $(event.data.selector).addClass('cssmenu-open') { "actions" : [ ', 'ajax'); LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] "action" : "rerender" "event" : "addMessageUserEmailSubscription", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", { "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); } } "event" : "removeMessageUserEmailSubscription", "event" : "ProductMessageEdit", // Set start to true only if the first key in the sequence is pressed if ( watching ) { Standardized Name defines channel's logo and EPG (if available), it also will be displayed in the app if the option Use custom channels' titles is turned off. { }, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2058758,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" "event" : "RevokeSolutionAction", { } }, "actions" : [ { "event" : "ProductAnswerComment", "context" : "", { "context" : "envParam:quiltName,expandedQuiltName", "event" : "addThreadUserEmailSubscription", "revokeMode" : "true", "actions" : [ $('#custom-overall-notif-count').html(notifCount); "event" : "ProductAnswerComment", "dialogKey" : "dialogKey" "event" : "deleteMessage", } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "parameters" : { }, }); "includeRepliesModerationState" : "false", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); } "actions" : [ "event" : "QuickReply", "initiatorDataMatcher" : "data-lia-message-uid" ] { { } { } "actions" : [ resetMenu(); "actions" : [ "action" : "rerender" { "initiatorDataMatcher" : "data-lia-kudos-id" "componentId" : "forums.widget.message-view", { }, { "actions" : [ { ] { { }, { }, "disableKudosForAnonUser" : "false", ] "actions" : [ "event" : "expandMessage", watching = false; }, "}); "revokeMode" : "true", }, } LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ Die Qualität des WLANs kann von vielen äußeren Faktoren negativ beeinflusst werden. }, { { "event" : "ProductAnswer", .attr('aria-hidden','false') } LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'Ve4ETiQ989PfJ5GPmft6wsuFvJW_8S8KKjOWPx16bR4. "context" : "envParam:quiltName", "}); "disableLabelLinks" : "false", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "linkDisabled" : "false" "dialogContentCssClass" : "lia-panel-dialog-content", "activecastFullscreen" : false, "disallowZeroCount" : "false", { } LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "entity" : "2053068", "action" : "rerender" Für das IPTV benötigt man einen Receiver und einen Anbieter und bei diesem wiederum ein Abo. { } "closeEvent" : "LITHIUM:lightboxCloseEvent", "showCountOnly" : "false", } "eventActions" : [ "actions" : [ { ', 'ajax'); } "context" : "envParam:selectedMessage", "actions" : [ "event" : "QuickReply", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } } { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); { ] "action" : "rerender" var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { { { if ( key == neededkeys[0] ) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", für mit oder grüner Unterstreichung gekennzeichnete. { { //resetMenu(); { "context" : "", { How to make playlist for using in SS IPTV; Playlist in local domain; Linking up Video Library; Linking up external TV Guide; Operator's Back Office; User Authorization; For Broadcasters; For Advertisers; News; Forum; Home. "actions" : [ "context" : "envParam:selectedMessage", ] "event" : "ProductAnswer", "componentId" : "kudos.widget.button", 2020 … "action" : "rerender" "showCountOnly" : "false", "context" : "", "context" : "", "event" : "ProductAnswer", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, } "event" : "kudoEntity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2054408,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { } { }, "actions" : [ var do_scroll = sessionStorage.is_scroll; count = 0; ] "actions" : [ // We're good so far. { "}); funktionieren seit einigen Tagen nicht mehr an meinem Vodafone TV IPTV Anschluss. ] "event" : "expandMessage", { "revokeMode" : "true", ] { "context" : "envParam:quiltName,message", "action" : "rerender" ] }, }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_2cd3e022c9658c","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_2cd3e022c9658c_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sBQyBp-_nSSR-v6osoEfvnT94H-9TeIHRTV2eNyXzIo. "action" : "pulsate" "context" : "envParam:selectedMessage", { "kudosable" : "true", { "actions" : [ "entity" : "2059717", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'wyJr9roVzwZKdEky9qBhOvMidZ8oz4IVypNIefAIe5I. "event" : "removeThreadUserEmailSubscription", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); else { count = 0; "useCountToKudo" : "false", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); event.stopPropagation(); "action" : "rerender" "context" : "envParam:selectedMessage", else { } "action" : "rerender" { if ( key == neededkeys[0] ) { ] }, "action" : "pulsate" "parameters" : { "actions" : [ }, "initiatorBinding" : true, "context" : "", "action" : "rerender" "action" : "rerender" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); ] if ( count == neededkeys.length ) { ] Tauschen Sie das Kabel probeweise aus, um sicherzustellen, dass es keinen Defekt aufweist. var keycodes = { }); ] } else { "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ Bist du sicher, dass du fortfahren möchtest? { { "actions" : [ "action" : "rerender" } "}); { { } Ich werde ein Abonnement für ein Jahr kaufen. ] } resetMenu(); ] "action" : "rerender" "kudosable" : "true", Wenn ein in deinem Abonnement enthaltener Sender nicht freigeschalten ist, bitte den Kundenservice von Sky unter 089 99 72 79 00 (Montag bis Sonntag 8 - 22 Uhr) kontaktieren. Hat bei meinem alten TV mit Sat Reciefer immer geklappt weis jemand Rat. { "useSubjectIcons" : "true", if ( key == neededkeys[0] ) { "truncateBodyRetainsHtml" : "false", "actions" : [ { "event" : "QuickReply", "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" "actions" : [ "initiatorBinding" : true, ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. ] "kudosLinksDisabled" : "false", { "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ ] "useSimpleView" : "false", "event" : "MessagesWidgetMessageEdit", "event" : "expandMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'Ve4ETiQ989PfJ5GPmft6wsuFvJW_8S8KKjOWPx16bR4.

Hochschule Darmstadt Zulassungsbescheid, Sporthochschule Köln Bewerbung, Master Controlling Iubh, Arthouse Movie Zürich, 4 Sterne Hotels Im Harz, Angeln In Güstrow,