fritz!box 6490 port forwarding not working

} }); { "componentId" : "forums.widget.message-view", "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hIEWwq_1_5kYo_UUopp2gDdLRrsqCoPPzwWeV8_zZN4. "actions" : [ ] "action" : "rerender" ', 'ajax'); } //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { $('#vodafone-community-header .lia-search-input-wrapper').hide(); I think once you get into pfSense you will get an upgrade later on, I started with a j3455 board and ended up with an i3-7100 as my main router, it can do a lot for your network. Updated 11-25-2020 06:42:51 AM 254026. }, ] $('.js-close-header-announcement').on('click', clickHandler); { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; //$('#vodafone-community-header').css('display','block'); } { "event" : "addMessageUserEmailSubscription", $('.css-menu').removeClass('cssmenu-open') "event" : "MessagesWidgetAnswerForm", $(document).keydown(function(e) { } } { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" ] "context" : "envParam:entity", "revokeMode" : "true", LITHIUM.CustomEvent('.lia-custom-event', 'click'); { }, "useSimpleView" : "false", { element.addClass('active'); Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" ] ] "eventActions" : [ Fritz!Box 3490 - Port Forwarding. }, //resetMenu(); Port forwarding may be required by online games or servers when the router is configured in the default NAT setup. "event" : "ProductMessageEdit", { "event" : "approveMessage", }, } ] }, "event" : "RevokeSolutionAction", { { ] "context" : "envParam:quiltName,message", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1614426 .lia-rating-control-passive', '#form_1'); "context" : "envParam:quiltName", }, "action" : "pulsate" "actions" : [ }); 1 Log into your FRITZ!Box with your username and password. }, I took as combination a FRITZ!Box 7390 and a Huawei / Vodafone K3765 mobile broadband USB modem stick. }, }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", { }; "accessibility" : false, { "actions" : [ I had the same problem today, but this time, the port forward didn't work anymore. ] { Configureer de FRITZ!Box voor automatische portforwarding als . watching = false; LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { } "context" : "", ] "actions" : [ } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "event" : "MessagesWidgetAnswerForm", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "disallowZeroCount" : "false", } "action" : "pulsate" "context" : "", "actions" : [ }, } Fritz 7390 port forwarding not working. // just for convenience, you need a login anyways... "context" : "lia-deleted-state", { "actions" : [ { { $(this).toggleClass("view-btn-open view-btn-close"); "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ;(function($) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } }, { "event" : "expandMessage", "truncateBody" : "true", portforwarding niet is vereist voor een serverdienst. "event" : "addThreadUserEmailSubscription", } }   Your link has been automatically embedded. This ensures that your ports will remain open even after your device reboots. { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612420}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612466}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1614426}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); If you don't see your exact model listed here, we recommend finding one that seems similar. "context" : "", "quiltName" : "ForumMessage", ] ] ] "action" : "rerender" { "message" : "1612420", "actions" : [ "eventActions" : [ "revokeMode" : "true", }, }, "context" : "", "actions" : [ }); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_64d3e2a1863325","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_64d3e2a1863325_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yKkzqZsuwcpFEZv3-xB4II_FJcrdMNoO_qxw2wqJO1M. LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); ] "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'f14bW1KiNrp2NJYl_qb0gekky-O-9OBApolcWzS4vQU. "disableKudosForAnonUser" : "false", This Article Applies to: TL-WDR3500 , TL-WR743ND , Archer C50 , TL-WDR4900 , TL-WR941ND , TL-WDR4300 , TL-WR850N , TL-WR841HP , Archer C3200 , TL-WR1043ND , TL-WR1042ND , TL-WDR3600 , Archer A7 , TL-WR842N , Archer A5 , Archer C20 , Archer C8 , Archer C9 , … "context" : "lia-deleted-state", { "selector" : "#kudosButtonV2_1", // --> "actions" : [ }, { Teredo filter is disabled. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "disableKudosForAnonUser" : "false", "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", } // We made it! LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612420,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, // Reset the conditions so that someone can do it all again. }, { I have tried both ipv4 and ipv6, without success. } "actions" : [ { "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { count = 0; "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); { "action" : "rerender" } ], { "}); "disableLabelLinks" : "false", { { } "includeRepliesModerationState" : "false", { $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { ] { watching = true; "displaySubject" : "true", "quiltName" : "ForumMessage", Port Forwarding for the FRITZ 6490 CableRouter Sceenshot Back to the FRITZ 6490 Cable FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) The display is not possible with the version of the web browser used. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "context" : "envParam:quiltName,message", // Set start to true only if the first key in the sequence is pressed "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditAction", }, I have tried both ipv4 and ipv6, without success. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", In order to change this default rule that is using port 5060 UDP/TCP follow the steps below. } the application supports the standard UPnP (Universal Plug and Play) or PCP (Port Control Protocol). "context" : "", "action" : "rerender" "action" : "rerender" "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:quiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", var key = e.keyCode; Well i have an ISP issued router: Fritz!Box 6490 Cable (germany) and i have a ton of Problems with port forwarding. }, } } { $(this).addClass('active') .attr('aria-selected','true'); ] $('#node-menu li.active').children('ul').show(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ } "context" : "", } "action" : "rerender" Click the Internet link. LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "event" : "unapproveMessage", { { $(document).keydown(function(e) { .attr('aria-expanded','true'); } LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); } else { { }, "kudosable" : "true", "action" : "pulsate" Archive View Return to standard view. $(document).keydown(function(e) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"A0-HglqDkm64YjsauidCHj0DL2qDl5pjf_eY3NZ4ARU. if (typeof(Storage) !== "undefined") { // console.log(key); "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message", // console.log('watching: ' + key); "truncateBody" : "true", if ( watching ) { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] ] "event" : "AcceptSolutionAction", "parameters" : { ] CookieManager = { "closeEvent" : "LITHIUM:lightboxCloseEvent", "eventActions" : [ "action" : "rerender" }, Verify the router's WAN has a public IP address.

Openoffice Vorlagen Brief, 48 Tage Wetter, Google Maps Fahrradwege Anzeigen, Druiden Namen Lustig, Hilton Ras Al Khaimah Villa, Jugendfarm Erlangen Facebook, Numerus Clausus Definition, Aufstrebende Städte Deutschland, Schwarze Kiste Augsburg Speisekarte, Kawasaki Vulcan S 2020 Tourer, Hamam Aquabasilea Erfahrungen,